PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.3102s0020.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family GRF
Protein Properties Length: 604aa    MW: 65639.9 Da    PI: 7.6485
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.3102s0020.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC75.45.9e-24216260145
                     WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                             d+epgrCrRtDGKkWRCsr++++ +k+CErH++rgr+rsrk++e 
  SapurV1A.3102s0020.1.p 216 DPEPGRCRRTDGKKWRCSRDAVAEQKYCERHMNRGRHRSRKPVEG 260
                             79****************************************985 PP

2QLQ59.31.2e-20147182237
                     QLQ   2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37 
                             +FT +Q+++L++Q+l+yKy+ an+P+P++Ll +i++
  SapurV1A.3102s0020.1.p 147 PFTQSQWMELEHQALIYKYITANVPIPSNLLIPIRN 182
                             8*********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009514.2E-11146182IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088802.3E-15147181IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166623.719147182IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166725.01216260IPR014977WRC domain
PfamPF088793.1E-20217259IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 604 aa     Download sequence    Send to blast
MDFGVQVGLD GLVGSDTSNN GFASLASSDP GAKQKYGSGL LKQERSAAAD DDWNNSKLSR  60
TESMLLDQRN ALLMKSNNSL FTDGQQQQQM LSFSCPKSAS SVARSSSNAI LPYFHLTSSA  120
YNRNTGYNPG IFNAASMHGV LTETGWPFTQ SQWMELEHQA LIYKYITANV PIPSNLLIPI  180
RNALDSAGFS SFSGGHFKPS ALKWGTFHMG FSSNTDPEPG RCRRTDGKKW RCSRDAVAEQ  240
KYCERHMNRG RHRSRKPVEG QPGHSVAATT TIKTMPNGTF SSTSSSVVGL CSAVSDSHTI  300
VHNLQQPASS SNISATDTLS SRVFLTTENV GERMQDVSGL SMLPSSIDLQ SKETPFFISK  360
QLKSYGESLR NEFARVTSDS LNHSQKSSSL MSCRNFGLSQ NLTEQESVSQ HSLRQFMDDW  420
PKSHSDRSAV SWPEPDMHYE RAQLSISTPM APADFMPSTS SPNNEKTTLP QLRLSREFDP  480
IQMGLGVGVG SIANEPNQRQ ANWIPISWET SMGGPLEEVL HITNYNATAE CKNASSLNLM  540
TERWDNSPRA GSSPTGVLQK SAFASLSNSS AGSSPRAENK INGGNLCHDL GSTIVHSSSL  600
SAL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF0422967e-58KF042296.1 Codiaeum variegatum GRF2 mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011017085.10.0PREDICTED: growth-regulating factor 1-like isoform X2
TrEMBLB9GNL90.0B9GNL9_POPTR; Uncharacterized protein
STRINGPOPTR_0002s11590.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20853481
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22840.12e-89growth-regulating factor 1